PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013594090.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 232aa    MW: 25829.7 Da    PI: 6.8792
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013594090.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.91e-172269148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd++l+++++ +G g W+t a+  g++Rt+k+c++rw++yl
   XP_013594090.1 22 KGPWTMEEDLILINYIANHGDGVWNTLAKSAGLKRTGKSCRLRWLNYL 69
                     79********************************************97 PP

2Myb_DNA-binding53.94.1e-1775118146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T+eE++++ ++++++G++ W++Ia++++ gRt++++k++w++
   XP_013594090.1  75 RGNITPEEQLIIMELHAKWGNR-WSKIAKHLP-GRTDNEIKNFWRT 118
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.4431769IPR017930Myb domain
SuperFamilySSF466898.99E-3020116IPR009057Homeodomain-like
SMARTSM007172.3E-122171IPR001005SANT/Myb domain
PfamPF002493.1E-162269IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.6E-232376IPR009057Homeodomain-like
CDDcd001675.72E-102469No hitNo description
PROSITE profilePS5129424.86570124IPR017930Myb domain
SMARTSM007175.0E-1574122IPR001005SANT/Myb domain
PfamPF002497.4E-1675118IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-2477123IPR009057Homeodomain-like
CDDcd001675.11E-1279118No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MDKRGGICSG GSGSSGETEV RKGPWTMEED LILINYIANH GDGVWNTLAK SAGLKRTGKS  60
CRLRWLNYLR PDVRRGNITP EEQLIIMELH AKWGNRWSKI AKHLPGRTDN EIKNFWRTRI  120
QKYIKQTDVA ATATSSVGSQ SSEINDHAAS TSAHNVFCAQ DQAMDTYSPT TTSYQHTNME  180
FNYGNYSAPV APVTTAATTA DYSVPMTVDD QTGENYWGMD DIWSSMHLLN GN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-26161241108B-MYB
1h8a_C6e-261912424128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN7039950.0JN703995.1 Brassica oleracea MYB1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013594090.11e-176PREDICTED: transcription factor MYB21-like
RefseqXP_013726483.11e-176PREDICTED: transcription factor MYB21-like
SwissprotQ9LK951e-143MYB21_ARATH; Transcription factor MYB21
TrEMBLA0A0D3DBD71e-176A0A0D3DBD7_BRAOL; Uncharacterized protein (Fragment)
STRINGBra025300.1-P1e-174(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27810.11e-141myb domain protein 21